PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676745442
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 251aa    MW: 28897.2 Da    PI: 10.3958
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676745442genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer94.21.1e-2960116259
  ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  ++++YkeC+kNhAa +Ggh+vDGC+Efmp  g+egt +alkCaAC+CHR+FHR+ev+ 
    676745442  60 HEAKYKECQKNHAALTGGHVVDGCCEFMPG-GKEGTLDALKCAACNCHRSFHRKEVHG 116
                  5789*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.6E-2762114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2263114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.3E-2763114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.48564113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.16E-18172245IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-26177245IPR009057Homeodomain-like
PROSITE profilePS500718.6182246IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-25184241IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDHGGKCNAI TSTARISTKA LEAKPHTNED PKAKPGSDPS LPPFLVKKEK QKPRARGEQH  60
EAKYKECQKN HAALTGGHVV DGCCEFMPGG KEGTLDALKC AACNCHRSFH RKEVHGHRNS  120
TQELISPAFY CSNTSYKAMQ PRVVYHQMGE IGRRTSSSSE DMKKILSQRS QNINENGLMK  180
MWKKKRIRTK INEEQKEKMK EFAERLGWRI QKKDEEEIDK FCRMVNLRRQ VFKVWMHNNK  240
QAMKRNGTLQ K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-191852471880ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741295.11e-130PREDICTED: zinc-finger homeodomain protein 7-like
SwissprotQ9SVL01e-125ZHD7_ARATH; Zinc-finger homeodomain protein 7
TrEMBLA0A078GV381e-129A0A078GV38_BRANA; BnaC07g31930D protein
TrEMBLA0A0D3DDV91e-129A0A0D3DDV9_BRAOL; Uncharacterized protein
STRINGAT3G50890.11e-123(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138541525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50890.11e-127homeobox protein 28